Loading...
Statistics
Advertisement

gtib.cn.com
www.gtib.cn.com/

Gtib.cn.com

Advertisement
Conversion Technology Metas Server
Gtib.cn.com is hosted in China / Beijing . Gtib.cn.com doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: Html, Javascript, Php, Number of used javascripts: 2. First javascripts: Caf.js, Parking_caf_281_1409192.js, Number of used analytics tools: 0. Its server type is: Tengine/1.4.2.

Technologies in use by Gtib.cn.com

Technology

Number of occurences: 3
  • Html
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 2
  • caf.js
  • parking_caf_281_1409192.js

Advertise

Number of occurences: 1
  • Google Adsense

Server Type

  • Tengine/1.4.2

Powered by

  • PHP/5.3.10

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Gtib.cn.com

Missing HTTPS protocol.

    Meta - Gtib.cn.com

    Number of occurences: 1
    • Name:
      Content: text/html; charset=utf-8

    Server / Hosting

    • IP: 103.232.215.150
    • Latitude: 39.93
    • Longitude: 116.39
    • Country: China
    • City: Beijing

    Rname

    • cn-com-wildcard-null-mx.centralnic.net

    HTTP Header Response

    HTTP/1.1 200 OK Server: Tengine/1.4.2 Date: Wed, 20 Apr 2016 03:46:52 GMT Content-Type: text/html;charset=utf-8 Connection: keep-alive Vary: Accept-Encoding X-Powered-By: PHP/5.3.10 Set-Cookie: PHPSESSID=660a5ceabd42aehtq9b49l2ls0; path=/ Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache

    DNS

    host: gtib.cn.com
    1. class: IN
    2. ttl: 600
    3. type: A
    4. ip: 103.232.215.150
    host: gtib.cn.com
    1. class: IN
    2. ttl: 600
    3. type: MX
    4. pri: 0
    5. target: cn-com-wildcard-null-mx.centralnic.net
    host: gtib.cn.com
    1. class: IN
    2. ttl: 600
    3. type: TXT
    4. txt: v=spf1 -all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.tib.cn.com, www.gstib.cn.com, www.stib.cn.com, www.gxtib.cn.com, www.xtib.cn.com, www.gytib.cn.com, www.ytib.cn.com, www.ghtib.cn.com, www.htib.cn.com, www.gntib.cn.com, www.ntib.cn.com, www.gctib.cn.com, www.ctib.cn.com, www.gdtib.cn.com, www.dtib.cn.com, www.getib.cn.com, www.etib.cn.com, www.grtib.cn.com, www.rtib.cn.com, www.gttib.cn.com, www.ttib.cn.com, www.gbtib.cn.com, www.btib.cn.com, www.gvtib.cn.com, www.vtib.cn.com, www.gib.cn.com, www.gtqib.cn.com, www.gqib.cn.com, www.gtaib.cn.com, www.gaib.cn.com, www.gt ib.cn.com, www.g ib.cn.com, www.gtwib.cn.com, www.gwib.cn.com, www.gteib.cn.com, www.geib.cn.com, www.gtzib.cn.com, www.gzib.cn.com, www.gtxib.cn.com, www.gxib.cn.com, www.gtcib.cn.com, www.gcib.cn.com, www.gtb.cn.com, www.gtirb.cn.com, www.gtrb.cn.com, www.gtifb.cn.com, www.gtfb.cn.com, www.gtivb.cn.com, www.gtvb.cn.com, www.gtikb.cn.com, www.gtkb.cn.com, www.gti,b.cn.com, www.gt,b.cn.com, www.gtibb.cn.com, www.gtbb.cn.com, www.gtigb.cn.com, www.gtgb.cn.com, www.gtitb.cn.com, www.gttb.cn.com, www.gtiyb.cn.com, www.gtyb.cn.com, www.gtiub.cn.com, www.gtub.cn.com, www.gtijb.cn.com, www.gtjb.cn.com, www.gtimb.cn.com, www.gtmb.cn.com, www.gtinb.cn.com, www.gtnb.cn.com, www.gti.cn.com, www.gtibq.cn.com, www.gtiq.cn.com, www.gtibw.cn.com, www.gtiw.cn.com, www.gtibz.cn.com, www.gtiz.cn.com, www.gtibx.cn.com, www.gtix.cn.com, www.gtib.cn.com, www.gti.cn.com, www.gtibs.cn.com, www.gtis.cn.com, www.gtiby.cn.com, www.gtiy.cn.com, www.gtibe.cn.com, www.gtie.cn.com, www.gtibd.cn.com, www.gtid.cn.com, www.gtibc.cn.com, www.gtic.cn.com,

    Other websites we recently analyzed

    1. medicalmalpracticelawyerpennsylvania.com
      Houston (United States) - 108.167.131.22
      Server software: Apache/2.2.27 (Unix) mod_ssl/2.2.27 OpenSSL/1.0.1e-fips DAV/2 mod_bwlimited/1.4
      Technology: Html
      Number of meta tags: 1
    2. EQ Logik - Sönke Wulff
      Germany - 213.203.239.230
      Server software: Apache/2.0.55 (Debian) FrontPage/5.0.2.2635 PHP/4.4.2-1+b1 mod_ssl/2.0.55 OpenSSL/0.9.8c
      Technology: Html
      Number of meta tags: 1
    3. Fasching-Karneval-Shop
      Spezialist für Karneval, Fasching, Halloween Oktoberfest Weihnachten, Nikolaus, Ostern, 60er Jahre, 70er Jahre, 80er Jahre, Mottopartys, Themenpartys, Karnevalskostüme, Faschingskostüme, Perücken, Brillen, Bärte, Jungesellenabschied und Zubehör
      Germany - 62.104.45.105
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery UI
      Number of Javascript: 11
      Number of meta tags: 5
    4. Hoststar - Webspace und Hosting mit vielen Vorteilen - Top Webhosting zum sensationellen Preis
      Wir bieten Ihnen Webhosting, Reseller-Hosting, Domains und vServer für Ihren Internetauftritt bereits ab CHF 5.90 pro Monat.
      Germany - 5.9.101.76
      Server software: Apache
      Technology: CSS, Html, Html5, SVG
      Number of meta tags: 3
    5. Harry Sturm & Associates Inc
      Check out this GoDaddy hosted webpage! http://hsa-recruiting.com.
      Scottsdale (United States) - 97.74.42.79
      Server software: Microsoft-IIS/7.0
      Technology: CSS, Html, Javascript, jQuery, jQuery UI
      Number of Javascript: 4
      Number of meta tags: 3
    6. AAU Golf > Home
      United States - 12.179.190.211
      Server software: Redirector/1.0
      Technology: CSS, Html, Javascript, jQuery, jQuery Hover Intent, jQuery UI, comScore, Google Analytics, Google Publisher Tag, DotNetNuke
      Number of Javascript: 12
      Number of meta tags: 7
    7. jelenka.eu - Na úvod
      Czech Republic - 89.185.253.48
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, jQuery, jQuery Cycle, Php, Swf Object
      Number of Javascript: 11
      Number of meta tags: 3
    8. Hi-Tact – Singapore's Scaffolding Solutions
      Singapore - 103.11.189.21
      Server software: Apache
      Technology: CloudFlare, CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Revslider, SVG, Wordpress
      Number of Javascript: 12
      Number of meta tags: 3
    9. Lynchburg & Roanoke Hyundai Provider | Robert Woodall Hyundai in Danville
      Make Robert Woodall Hyundai in Danville your Lynchburg and Roanoke source for new and used cars, OEM parts, service & financing!
      Europe - 2.20.189.9
      Server software: squid/3.5.14
      Technology: CSS, Flexslider, Html, Javascript, SVG
      Number of Javascript: 6
      Number of meta tags: 6
    10. oneinstant.com
      Scottsdale (United States) - 184.168.221.32
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe

    Check Other Websites